DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp9

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_075249.1 Gene:Aqp9 / 65054 RGDID:68433 Length:295 Species:Rattus norvegicus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:121/275 - (44%) Gaps:47/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDLFPNNHLQIV-LNFGF--AVLIAIQCFGCVSGAHLNPAVTVAA 122
            |.|.:||.|::.|||....:..|.......|: :|.||  ||::|:.....:||.|:||||:.|.
  Rat    27 LSEFLGTFIMIVLGCSSIAQAVLSRERFGGIITINIGFASAVVMALYVTFGISGGHINPAVSFAM 91

  Fly   123 YIY-EMVTLRMAFAYFAAQMLGAFIG--------YGLLMVLLPSPTLTVG----AGLCVTLPHTS 174
            ..: .|...:..| |..||.||||:|        |..||.......|.||    |.:..|.|...
  Rat    92 CAFGRMEWFKFPF-YVGAQFLGAFVGAATVFGIYYDGLMAFAGGKLLVVGENATAFIFATYPAPF 155

  Fly   175 VTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIR-------FGLAIACLACAAGPFTGGS 232
            ::|..|...:.|.|..|:::...::|.||      :|:.       .||.|..|:|:.|..:|.:
  Rat   156 ISTPGAFVDQVVSTMFLLLIVFAMFDSRN------LGVPRGLEPVVIGLLIIVLSCSLGLNSGCA 214

  Fly   233 MNPARSFAPAL------WNKHFESNWI---YWLAPLSSSAITAYAYKVVF------RREVVEAEI 282
            |||||..:|.|      |.  ||...:   :|..|:....|.|:...:::      ....::.::
  Rat   215 MNPARDLSPRLFTALAGWG--FEVFTVGNNFWWIPVVGPMIGAFLGGLIYILFIQMHHSKLDPDM 277

  Fly   283 TSNEKLRQLEDVQLS 297
            .:......||..:||
  Rat   278 KAEPSENNLEKHELS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 73/242 (30%)
Aqp9NP_075249.1 MIP 4..266 CDD:412216 73/247 (30%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 84..86 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 216..218 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.