DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp9

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001258772.1 Gene:Aqp9 / 64008 MGIID:1891066 Length:321 Species:Mus musculus


Alignment Length:243 Identity:71/243 - (29%)
Similarity:106/243 - (43%) Gaps:44/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IVLNFGF--AVLIAIQCFGCVSGAHLNPAVTVAAYIY-EMVTLRMAFAYFAAQMLGAFIG----- 147
            |.:|.||  ||::|:.....|||.|:||||:.|...: .|...:..| |..||:||||:|     
Mouse    84 ITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPF-YVGAQLLGAFVGAATVF 147

  Fly   148 ---YGLLMVLLPSPTLTVG----AGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSK 205
               |..||.......|..|    |.:..|.|...|:...|...:.|.|..|:::...::|.||  
Mouse   148 GIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIFDSRN-- 210

  Fly   206 FHDSVG-------IRFGLAIACLACAAGPFTGGSMNPARSFAPAL------WNKH---FESN--W 252
                :|       |..||.|..::|:.|..:|.:|||||..:|.|      |...   |.:|  |
Mouse   211 ----LGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFGNNFWW 271

  Fly   253 IYWLAPLSSSAITAYAYKVVF---RREVVEAEITSNEKLRQLEDVQLS 297
            |..:.|:..:.:....| |:|   .....:.|:.:......||..:||
Mouse   272 IPVVGPMIGAVLGGLIY-VLFIQMHHSNPDPEVKAEPAENNLEKHELS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 64/213 (30%)
Aqp9NP_001258772.1 MIP <61..292 CDD:294134 65/215 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.