DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp9a

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001028268.1 Gene:aqp9a / 606660 ZFINID:ZDB-GENE-050809-119 Length:294 Species:Danio rerio


Alignment Length:273 Identity:78/273 - (28%)
Similarity:111/273 - (40%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FLGELIGTGILVFLGCMGCVKTDLFPN---NHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA 121
            ||.|.:||.:||..||....:|.|..|   ..|.|.:.|...:::.:...|.|||.||||||::|
Zfish    15 FLAEFLGTFVLVLFGCGSVAQTVLSRNTLGEPLTIHIGFSTGLMMGVYVSGGVSGGHLNPAVSLA 79

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIG----YGL---LMVLLPSPTLTVGAGLCVT------LP-- 171
            ..|...:.:.....|..|||||||.|    :||   ..:...|..|:| .|:..|      .|  
Zfish    80 MVILGKLKIWKFPVYVIAQMLGAFAGAAAVFGLYYDAFMEFTSGILSV-TGINATGHIFSSYPGR 143

  Fly   172 HTSVTTG---QALGIEFVITSILVIVCCGVWDPRNSKFHDSVG-------IRFGLAIACLACAAG 226
            |.:|..|   |.:|...::..||.||     |.||      :|       :..|:.:..::.:.|
Zfish   144 HLTVLGGFVDQVVGTGMLVLCILAIV-----DGRN------IGAPRGVEPLAVGVVLLGISVSMG 197

  Fly   227 PFTGGSMNPARSFAPAL------WNKHFESNWIYW-----LAPLSSSAITAYAYKVVFRREVVEA 280
            ...|..:||||...|.|      |.....|...||     ..||....:.|..|.::........
Zfish   198 LNCGYPLNPARDLGPRLFTALAGWGMEVFSTADYWWWIPVAGPLVGGVVGAVIYFLLIELHHSNH 262

  Fly   281 EITSNEKLRQLED 293
            ..|..|:..:.||
Zfish   263 NDTPQEEPEEEED 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 74/250 (30%)
aqp9aNP_001028268.1 MIP 11..255 CDD:294134 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.