DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp9b

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001171215.1 Gene:aqp9b / 570191 ZFINID:ZDB-GENE-070911-1 Length:291 Species:Danio rerio


Alignment Length:281 Identity:78/281 - (27%)
Similarity:118/281 - (41%) Gaps:64/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIV-LNFGF--AVLIAIQCFGCVSGAHLNP 116
            |.|..||.||:||.:|:..||....:|.|......|:: ::|||  .|::|:...|.|||.|:||
Zfish    19 DIIREFLAELLGTFVLILFGCGSVAQTVLSREAKGQLLTIHFGFTLGVMLAVYMAGGVSGGHVNP 83

  Fly   117 AVTVAAYIYEMVTLRMAFAYFAAQMLGAFIG----------------YGLLMVLLPSPTLTVGAG 165
            ||::|..:...:.|:....|..||.||||.|                .|.|.|..|:.|    ||
Zfish    84 AVSLAMVVLRKLPLKKFPVYVLAQFLGAFFGSCAVYCLYYDAFTEFANGELAVTGPNVT----AG 144

  Fly   166 LCVTLPH--TSVTTG---QALGIEFVITSILVIVCCGVWDPRNSKFHDSVG-------IRFGLAI 218
            :..:.|.  .|:..|   |.:|...::..||.:|     |.:|      :|       :..||:|
Zfish   145 IFASYPREGLSLLNGFIDQVIGAGALVLCILAVV-----DKKN------IGAPKGMEPLLVGLSI 198

  Fly   219 ACLACAAGPFTGGSMNPARSFAPAL------WNKHFESN-----WIYWLAPLSSSAITAYAYKVV 272
            ..:..:.....|..:||||...|.|      |.....|.     |:..:.|:....:.|..|.: 
Zfish   199 LAIGVSMALNCGYPINPARDLGPRLFTAIAGWGLTVFSAGNGWWWVPVVGPMVGGVVGAAIYFL- 262

  Fly   273 FRREVVEAEITSNEKLRQLED 293
                ::|.....|:|  .|||
Zfish   263 ----MIEMHHPENDK--NLED 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 70/254 (28%)
aqp9bNP_001171215.1 MIP 22..228 CDD:238204 64/220 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573501
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.