DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp8a.2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001073651.1 Gene:aqp8a.2 / 563130 ZFINID:ZDB-GENE-070112-1802 Length:257 Species:Danio rerio


Alignment Length:230 Identity:59/230 - (25%)
Similarity:106/230 - (46%) Gaps:14/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIY 125
            :.||:||...||:||:..:: ::.....||..|..|.||.:.:.|...:||:|.||..|:|.::.
Zfish    37 IAELVGTTFFVFIGCVSVIE-NVEAAGRLQPALVHGLAVAVLVACMAEISGSHFNPPFTIAIWLC 100

  Fly   126 EMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSI 190
            ..:.|.|...|..:|::|..:|..:..|:..........|....:..:....|:.:..|..:|.:
Zfish   101 GGMQLTMVVPYLISQLIGGVLGAAMSKVMTSDENYANATGAAFAVLKSDEQLGKVVFAEMAMTCL 165

  Fly   191 L-VIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWIY 254
            : ::|..|..:.::..  ..|....|..:.....|.|..:|..:||||:|.|||...|:..:|:|
Zfish   166 VTLVVLMGAVNGKSKS--PMVPFMVGCTVIVNILAGGDVSGTCLNPARAFGPALVANHWTYHWVY 228

  Fly   255 WLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLR 289
            |:.||....:.|...::          :..:||||
Zfish   229 WVGPLGGGLVAAALMRL----------LLGDEKLR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 55/211 (26%)
aqp8a.2NP_001073651.1 MIP 36..246 CDD:294134 55/221 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.