DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp1a.2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001129154.1 Gene:aqp1a.2 / 559284 ZFINID:ZDB-GENE-100409-1 Length:269 Species:Danio rerio


Alignment Length:224 Identity:73/224 - (32%)
Similarity:113/224 - (50%) Gaps:8/224 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCV--KTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA 121
            |.|.|.:|..|.||:|....:  |.:.:|:..:::.|.||.|:....|..|.:||||||||:|:.
Zfish    13 AVLAEFVGMTIFVFIGIASAIGNKHNRYPDQEVKVALAFGLAIATLAQSLGHISGAHLNPAITLG 77

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFV 186
            ..:...::...||.|..||||||.:..|::..:.|.|..|:|    :.:....|..||...||..
Zfish    78 LLVSCQISFFRAFMYIIAQMLGAVLASGIMFKVSPDPDTTLG----LNMLGNGVKVGQGFAIELF 138

  Fly   187 ITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESN 251
            .|..||:......|...:....|..:..||::......|..:||..:||||||.||:..:.|:::
Zfish   139 TTFQLVLCALATTDKNRTDVSGSAPLAIGLSVGLGHLVAISYTGCGINPARSFGPAVVLESFKNH 203

  Fly   252 WIYWLAPLSSSAITAYAYKVVF--RREVV 278
            ||||:||:......|..|..:.  :||.:
Zfish   204 WIYWIAPMCGGVAAALIYDFLLFPKREAL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 71/214 (33%)
aqp1a.2NP_001129154.1 MIP 4..221 CDD:278651 70/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.