DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp8b

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001108382.2 Gene:aqp8b / 555598 ZFINID:ZDB-GENE-080220-47 Length:254 Species:Danio rerio


Alignment Length:241 Identity:61/241 - (25%)
Similarity:102/241 - (42%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KMKGSTLDK----------------ISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFG 96
            ||:.:.:||                :...:.||:||...|.:||: ||.......:.||..|..|
Zfish     5 KMEKAAMDKMVQETEMEEPGLFEQLVQPCMAELVGTAFFVLMGCL-CVIESAQEGHTLQAALVHG 68

  Fly    97 FAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLT 161
            .|:.:.|.|...:||:|.||:.|:|.::...:.|:|...|..:|:.|..:|..:...:..|....
Zfish    69 LALAVVIGCMVEISGSHFNPSFTIAVFLSGGLELKMVLPYLISQVSGGLLGAVMAKGMTSSEKYA 133

  Fly   162 VGAGLCVTLPHTSVTTGQALGIEFVITSI--LVIVCCGVWDPRNSKFHDSVGIRFGLAIACL--- 221
            ...|...|:........:||..|..:|.:  |.::...|    |.|   |....|...:.|.   
Zfish   134 QAQGAAFTVLQADDHIMKALFAEAAMTCLATLAVLLSAV----NGK---SKNHMFPFLVGCTVMV 191

  Fly   222 -ACAAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITA 266
             ..|....:|..:||.|:..||:...::..:||||:.|::...|.|
Zfish   192 NVLAGANVSGACLNPVRALGPAVLTNYWTHHWIYWVGPITGGLIAA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 57/214 (27%)
aqp8bNP_001108382.2 MIP 33..243 CDD:294134 57/213 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.