DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001015749.1 Gene:aqp2 / 548466 XenbaseID:XB-GENE-481401 Length:273 Species:Xenopus tropicalis


Alignment Length:223 Identity:80/223 - (35%)
Similarity:110/223 - (49%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCV---KTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAV 118
            :.|...|.:.|.|.|||| ||..   |..|  .|.|||.|.||.|:...:|.||.:||||:||||
 Frog    11 VRAVFAEFLATMIFVFLG-MGSALSWKPSL--PNVLQISLAFGLAISTLVQAFGHISGAHINPAV 72

  Fly   119 TVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGI 183
            |:|..|...::...|..|..||::||..|..::..:.|   |.....|.:. ..|:.:.|||..:
 Frog    73 TIAFLIGCHISFLRALFYIIAQLVGAIAGAAIVSAIAP---LDARGNLAIN-EVTNGSPGQACAV 133

  Fly   184 EFVITSILVIVCCGVWDPRNSKFHDSVG---IRFGLAIACLACAAGPFTGGSMNPARSFAPALWN 245
            |..:|..||:......|.|.|   |:||   |..||::..........||.||||||||.||...
 Frog   134 ELFLTFQLVLCVFASTDSRRS---DNVGSPAISIGLSVTVGHLLGIYLTGCSMNPARSFGPAAIT 195

  Fly   246 KHFESNWIYWLAPLSSSAITAYAYKVVF 273
            ..|..:|::|:.||....:.:..|..:|
 Frog   196 GIFTDHWVFWIGPLVGGILASLFYNYIF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 79/218 (36%)
aqp2NP_001015749.1 MIP 4..219 CDD:333943 78/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.