DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp7

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001015726.1 Gene:aqp7 / 548443 XenbaseID:XB-GENE-484060 Length:299 Species:Xenopus tropicalis


Alignment Length:268 Identity:68/268 - (25%)
Similarity:117/268 - (43%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDLFPN---NHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAA 122
            |.||:.|.|::..|...|.:..|..:   .:|.|.|:|||.|.:.|...|.|||||:|.||::..
 Frog    26 LAELLSTFIMMLFGLGSCAQVVLGKHEFGQYLSINLSFGFGVTMGIHVAGGVSGAHMNSAVSLTN 90

  Fly   123 YIYEMVTLRMAFAYFAAQMLGAFIGY----------------GLLMVLLPSPTLTVGAGLCVTLP 171
            .:...:..|....|..|||||:|:..                |:..|..|:.|    |.:..|.|
 Frog    91 CVLGNLPWRKLPVYVLAQMLGSFLAAVVVYCLYSEALYNYCGGIFTVTGPNET----ASIFATYP 151

  Fly   172 HTSVTTGQALGIEFVITSILVIVCCGVWDPRNS-KFHDSVGIRFGLAIACLACAAGPFTGGSMNP 235
            ...::.|.....:.:.|..|::....:.|.:|| ....:..:..||.:..:..:.|..:|.::||
 Frog   152 QPYLSIGGGFLDQVIGTGALLLCLLAIGDRKNSPALKGTEAVIVGLLVTVIGMSMGMNSGYAINP 216

  Fly   236 ARSFAPALWNK------------HFESNWIYWLAPLSSSAITAYAYK-VVFRREVVEAEITSNEK 287
            ||...|.::..            |:.| |:..:||.......|:.|| :|......|.|.|..|:
 Frog   217 ARDLGPRIFTAIAGWGIEVFRAGHYWS-WVPIVAPCVGGLTGAFLYKLLVGLHHQPEEEETKEEE 280

  Fly   288 LRQLEDVQ 295
            :.::::::
 Frog   281 VTKMDEME 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 63/243 (26%)
aqp7NP_001015726.1 MIP 21..266 CDD:350945 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.