DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp8a.1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001004661.1 Gene:aqp8a.1 / 447923 ZFINID:ZDB-GENE-040912-106 Length:260 Species:Danio rerio


Alignment Length:260 Identity:73/260 - (28%)
Similarity:118/260 - (45%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSLFSVALF----------KR--FSDHFSCCKVFKMKGSTLDKISAFLGELIGTGILVFLGCMGC 78
            |.||:||..          |:  |.:|:               |...|.|::|:.:.:|:||:. 
Zfish     8 SELFTVATGDGGDNHQNQPKKLPFFEHY---------------IQPCLAEVVGSFLFMFVGCVS- 56

  Fly    79 VKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLG 143
            |..::..:..:|..|..|.|:.|||..||.:||.|.||||:|..|:...:.:.:...|..:||||
Zfish    57 VMGNVGISGSIQPALAHGLALAIAIAIFGEISGGHFNPAVSVCVYLIGGMEVILLVPYIISQMLG 121

  Fly   144 AFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSIL-VIVCCGVWDPRNSKFH 207
            ..|...|...:..:...:...|.......:|...|.|...|.::|..| ::|..|..:.|...  
Zfish   122 GVIAASLAKAVTTNDAFSNATGAAFNAIPSSDGIGAATMAEMIMTLFLTIVVSMGAVNGRTKS-- 184

  Fly   208 DSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVV 272
            .......||.:.....|.|..:|..|||||:|.||:.:.|:..:||||:.||:.:.:|....::|
Zfish   185 QLAPFCIGLTVTANILAGGGISGACMNPARAFGPAVVSGHWTHHWIYWVGPLTGALVTVSIVRLV 249

  Fly   273  272
            Zfish   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 63/213 (30%)
aqp8a.1NP_001004661.1 MIP 39..249 CDD:294134 63/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.