DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp4

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001345242.1 Gene:aqp4 / 445293 ZFINID:ZDB-GENE-040724-152 Length:346 Species:Danio rerio


Alignment Length:248 Identity:83/248 - (33%)
Similarity:124/248 - (50%) Gaps:11/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FKRFSDHFSCCK--VFKMKGS-TLDKISAFLGELIGTGILVFLGC-----MGCVKTDLFPNNHLQ 90
            |:|.....||..  :...||. |.:...|..||.:...|.|.|..     .|..:.:..|.:.:.
Zfish    10 FRRCVSSCSCNNSIMAAFKGVWTQEFWRAVSGEFLAMIIFVLLSLGSTINWGAKQENPPPADLVL 74

  Fly    91 IVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLL 155
            |.|.||.::...:||||.:||||:|||||||......::|.....|..||.|||.:|..:|..:.
Zfish    75 ISLCFGLSIATLVQCFGHISGAHINPAVTVAMVATRKLSLAKGVFYLLAQCLGAVVGAAILYGVT 139

  Fly   156 PSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIAC 220
            |:   :|..|:.||..:..::.|.|:.||.:||..||.......||:.:....|..:..||::..
Zfish   140 PA---SVRGGMGVTSVNEEISAGHAIVIELIITFELVFTVFATCDPKRNDLKGSAALAIGLSVCI 201

  Fly   221 LACAAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVF 273
            ....|.|:||.||||||||.||:....::.:|:||:.||....:.|..|:.:|
Zfish   202 GHLFAIPYTGASMNPARSFGPAVIMVKWQDHWVYWVGPLIGGILAAAVYEYLF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 75/217 (35%)
aqp4NP_001345242.1 MIP 32..250 CDD:278651 75/220 (34%)
DUF737 <290..>345 CDD:310129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.