DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp10a

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001002349.1 Gene:aqp10a / 436621 ZFINID:ZDB-GENE-040718-40 Length:293 Species:Danio rerio


Alignment Length:292 Identity:70/292 - (23%)
Similarity:124/292 - (42%) Gaps:59/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KVFKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIV---LNFGFAVLIAIQCF 106
            |..|:|.....:|   :||::||.:|:..||....:.........|.:   :.|...|:.|:...
Zfish     2 KRMKVKNELARQI---MGEILGTFVLLLFGCAAAAQVKTSRETKGQFLSGNIAFSVGVMSAMYLC 63

  Fly   107 GCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL-------LPSPTLTV-- 162
            ..||||||||||:::..:...:.......|..||:|||::..||:.::       .....|||  
Zfish    64 RAVSGAHLNPAVSLSFCVLGDLAWIKLLPYSLAQILGAYLASGLVYLIYHDAIMEFSGGVLTVFG 128

  Fly   163 ---GAGLCVTLPHTSVTTGQALGIEFVI-TSILVIVCCGVWDPRNSKFHDS----------VGIR 213
               .|.:..|.| |.|.:.|...::.|: |::|::....:.|.||:...::          :||.
Zfish   129 PNETASIFATYP-TDVVSVQTNFLDQVVGTAMLMLCILPLNDKRNAPAPEALLPPIVATVVLGIS 192

  Fly   214 FGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNW----------IYWL---APLSSSAIT 265
            ..::..|         |.::||||...|.|:.  |.:.|          .:|:   ||:....:.
Zfish   193 ISMSANC---------GAAINPARDLGPRLFT--FTAGWGTEVFTCYDYFFWIPLVAPMVGGVLG 246

  Fly   266 AYAYKVVFRREVVEAEITS-----NEKLRQLE 292
            :..|.|..:..:.|.|..|     |::.:.:|
Zfish   247 SIIYLVFIQWHLPELEDESESGEMNDQTKVME 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 60/251 (24%)
aqp10aNP_001002349.1 MIP 12..260 CDD:294134 62/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573489
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.