DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and MIP

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_036196.1 Gene:MIP / 4284 HGNCID:7103 Length:263 Species:Homo sapiens


Alignment Length:211 Identity:71/211 - (33%)
Similarity:107/211 - (50%) Gaps:3/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            |...|...|...||.|....::....|.:.||:.:.||.|:...:|..|.:||||:|||||.|..
Human    12 AIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFL 76

  Fly   124 IYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVIT 188
            :...::|..||.|.|||:|||..|..:|..:.|.   .|...|.:...|.:|:.|||..:|..:|
Human    77 VGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPP---AVRGNLALNTLHPAVSVGQATTVEIFLT 138

  Fly   189 SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWI 253
            ...|:.....:|.|.:....||.:..|.::|........:||..||||||||||:...:|.::|:
Human   139 LQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWV 203

  Fly   254 YWLAPLSSSAITAYAY 269
            ||:.|:....:.:..|
Human   204 YWVGPIIGGGLGSLLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 71/211 (34%)
MIPNP_036196.1 MIP 3..219 CDD:333943 70/209 (33%)
NPA 1 68..70 1/1 (100%)
NPA 2 184..186 1/1 (100%)
Interaction with CALM. /evidence=ECO:0000250 227..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.