DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp3a

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_998633.1 Gene:aqp3a / 406777 ZFINID:ZDB-GENE-040426-2826 Length:296 Species:Danio rerio


Alignment Length:296 Identity:86/296 - (29%)
Similarity:119/296 - (40%) Gaps:62/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 STLDKISAF-----------LGELIGTGILVFLGCMGCVKTDLFPNNH---LQIVLNFGFAVLIA 102
            |.|||::..           |.|.:||.|||..||....:..|...:|   |...|.|||...:.
Zfish     6 SVLDKLAQTFQIRNKLLRQGLAECLGTLILVMFGCGSLAQLKLSEGSHGLFLTANLAFGFGATLG 70

  Fly   103 IQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGL----------------- 150
            |...|.|||.|||||||.|..:......|....||..|.||:|:|..:                 
Zfish    71 ILVCGQVSGGHLNPAVTFALCLLGREKWRKFPVYFLFQTLGSFLGAAIIFAEYHDAIYDYAGESN 135

  Fly   151 -LMVLLPSPTLTVGAGLCVTLPHTSVTT-----GQALGIEFVITSILVIVCCGVWDPRNSKFHDS 209
             |:||....|    ||:..|.|...:|.     .|.:|...:|..||.||     ||.|:.....
Zfish   136 ELLVLGEKET----AGIFATYPSKYLTPLNGFFDQVIGTASLIVCILAIV-----DPYNNPIPQG 191

  Fly   210 V-GIRFGLAIACLACAAGPFTGGSMNPARSFAPAL------WNKHFESNWIYW-LAPLSSSAITA 266
            : ....|.::..:..:.|..:|.::||||.|.|.|      |.....:...|| |.|:.:..|.|
Zfish   192 LEAFTVGFSVLIIGLSMGFNSGYAVNPARDFGPRLFTAMAGWGSEVFTARDYWFLVPIFAPFIGA 256

  Fly   267 YAYKVVFRREV---VEAE-----ITSNEKLRQLEDV 294
            ....:|::..|   ||.|     ..:.|::..|.||
Zfish   257 VIGVIVYQLMVGWHVEGEARDKKAKAREEVMNLNDV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 73/257 (28%)
aqp3aNP_998633.1 MIP 23..266 CDD:238204 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.