Protein Alignment Eglp4 and rars1

DIOPT Version :9

• Sequence 1: NP_001261154.1
• Gene: Eglp4 / 37739
• FlyBaseID: FBgn0034885
• Length: 297
• Species: Drosophila melanogaster
• Sequence 2: NP_989403.1
• Gene: rars1 / 395040
• XenbaseID: XB-GENE-955966
• Length: 660
• Species: Xenopus tropicalis
• Alignment Length: 42
• Identity: 11/42 - (26%)
• Similarity: 24/42 - (57%)
• Gaps: 4/42 - (9%)

  Fly   175 VTTGQALGIEFVITSILVIVCCGVWDPRNSKF-HDSVGIRFG 215
            :.:|||:.::.|.::..:|   |.:||:.::. |...|:..|
 Frog   408 IDSGQAIHMQNVFSAGRMI---GWYDPKVTRIEHAGFGVVLG 446

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Eglp4	NP_001261154.1	MIP	59..272	CDD:294134	11/42 (26%)
rars1	NP_989403.1	Could be involved in the assembly of the multisynthetase complex. /evidence=ECO:0000250	1..72
		Syntaphilin	<9..>79	CDD:373718
		PLN02286	79..660	CDD:215160	11/42 (26%)
		L-arginine binding. /evidence=ECO:0000250|UniProtKB:P54136	200..202
		'HIGH' region	201..212
		Interaction with tRNA. /evidence=ECO:0000250|UniProtKB:Q05506	529..543

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000054
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000