DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Eglp3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster


Alignment Length:253 Identity:122/253 - (48%)
Similarity:171/253 - (67%) Gaps:7/253 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSG 111
            ::::|.....|:.|.|||..|.:.||:.|||||:|.||.|:|.:..|.||.|:||||||||.|||
  Fly    17 WRLEGHQRSAIACFFGELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSG 81

  Fly   112 AHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVG----AGLCVTLPH 172
            ||||||:|:||::|..:....|.|||.||..||.||||||:.:||..::. |    :|:|||:..
  Fly    82 AHLNPAITLAAWLYGAIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIK-GVDNPSGVCVTILA 145

  Fly   173 TSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPAR 237
            ..::..|.:.|||:||..||:|.|.||||||:|..|||.:||||.::||...||.|||.||||.|
  Fly   146 PGISVLQGVFIEFLITCCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTR 210

  Fly   238 SFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEI-TSNEKLRQLEDV 294
            |..||:||..:..:||||:.||.:.|:|:..|::.|:.: .|.:: ||:.|:|.:.:|
  Fly   211 SLGPAVWNDSWAHHWIYWVGPLVAGAVTSLIYRMAFKGD-EEIDLRTSDAKIRMIGEV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 113/216 (52%)
Eglp3NP_611812.2 MIP 30..244 CDD:294134 113/214 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471466
Domainoid 1 1.000 93 1.000 Domainoid score I390
eggNOG 1 0.900 - - E1_COG0580
Homologene 1 1.000 - - H136579
Inparanoid 1 1.050 92 1.000 Inparanoid score I335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26905
OrthoDB 1 1.010 - - D101773at6656
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51421
orthoMCL 1 0.900 - - OOG6_100415
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
1312.810

Return to query results.
Submit another query.