DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Eglp1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_611810.1 Gene:Eglp1 / 37736 FlyBaseID:FBgn0034882 Length:238 Species:Drosophila melanogaster


Alignment Length:197 Identity:71/197 - (36%)
Similarity:111/197 - (56%) Gaps:10/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAH 113
            ::|:|         |...|.:|:.|||||........:..|...:::|..|::.:..||.|||||
  Fly     9 IRGAT---------EFSATALLILLGCMGDSTNQGGESKFLVASVHYGLTVMVVMHVFGFVSGAH 64

  Fly   114 LNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVG-AGLCVTLPHTSVTT 177
            .||.::::.|:...:.|.:...|...||.|||:||.|||.|||...:... .|:|:..|..:::|
  Fly    65 SNPCISISCYLMGYIALEVMMMYVVCQMAGAFLGYFLLMQLLPKELVDKSKPGICLVQPMDTLST 129

  Fly   178 GQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPA 242
            .|.:.||.::|::||:..|.:||.||.:|.|||.||.||.:...:.|....||.|||||::..||
  Fly   130 YQVVIIECLLTAVLVLGWCSLWDVRNGRFLDSVAIRMGLLVIACSFAGIQLTGASMNPAKTLVPA 194

  Fly   243 LW 244
            ::
  Fly   195 IF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 69/187 (37%)
Eglp1NP_611810.1 MIP 13..223 CDD:294134 70/193 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471469
Domainoid 1 1.000 93 1.000 Domainoid score I390
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I335
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101773at6656
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 1 0.900 - - OOG6_100415
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
1110.800

Return to query results.
Submit another query.