DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AQP7

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001161.1 Gene:AQP7 / 364 HGNCID:640 Length:342 Species:Homo sapiens


Alignment Length:246 Identity:62/246 - (25%)
Similarity:102/246 - (41%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVKTDLFP---NNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAV 118
            :..||.|.:.|.:::..| :|.|...:..   .::|.:.|.|||.|.:.:...|.:||||:|.||
Human    34 VREFLAEFMSTYVMMVFG-LGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAV 97

  Fly   119 TVAAYIYEMVTLRMAFAYFAAQMLGAFIGY----------------GLLMVLLPSPTLTVGAGLC 167
            |.|......|..|....|...|.||:|:..                |.|||..|..|    ||:.
Human    98 TFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSGGQLMVTGPVAT----AGIF 158

  Fly   168 VTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNS-KFHDSVGIRFGLAIACLACAAGPFTGG 231
            .|.....:|..:....|..:|.:|.:....:.|..|: ....:..:..|:.:..:..:.|..||.
Human   159 ATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGY 223

  Fly   232 SMNPARSFAPAL------WNKHFES---NWIYWLAPLSSSAITAYAYKVVF 273
            ::||:|...|.:      |.|...|   ||  |..|:.:..:.||...:::
Human   224 AINPSRDLPPRIFTFIAGWGKQVFSNGENW--WWVPVVAPLLGAYLGGIIY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 62/241 (26%)
AQP7NP_001161.1 MIP 31..280 CDD:412216 62/246 (25%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 94..96 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 226..228 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.