DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AQP6

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001643.2 Gene:AQP6 / 363 HGNCID:639 Length:282 Species:Homo sapiens


Alignment Length:230 Identity:76/230 - (33%)
Similarity:117/230 - (50%) Gaps:13/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CKVFKMKGSTLDKIS-AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFG 107
            |:::|       .|| |...|.:.||:.||.|....::......:.|||.:.|.....:|:|...
Human    17 CRLWK-------AISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAITFNLVTAMAVQVTW 74

  Fly   108 CVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPH 172
            ..||||.|||||:|..:...::|..|.||.|||::||.:|..||..::|.   .:...|.:.:..
Human    75 KASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYGVMPG---DIRETLGINVVR 136

  Fly   173 TSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPAR 237
            .||:||||:.:|.::|..||:......|.|.:.  .|.....|:::|........|||.||||||
Human   137 NSVSTGQAVAVELLLTLQLVLCVFASTDSRQTS--GSPATMIGISVALGHLIGIHFTGCSMNPAR 199

  Fly   238 SFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVV 272
            ||.||:....|..:|::|:.||..:.:.:..|..|
Human   200 SFGPAIIIGKFTVHWVFWVGPLMGALLASLIYNFV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 71/212 (33%)
AQP6NP_001643.2 MIP 25..231 CDD:294134 70/210 (33%)
NPA 1 82..84 1/1 (100%)
NPA 2 196..198 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2887
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.