DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Prip

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster


Alignment Length:256 Identity:81/256 - (31%)
Similarity:114/256 - (44%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KMKGSTLDKISAFLGELIGTGILVFLGCMGC--VKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVS 110
            ::|...|....|.:||.:|..||.|..|..|  ::...|.      .|.||.|:.:||...|.:|
  Fly    12 ELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTFK------ALAFGLAIFMAITIVGHLS 70

  Fly   111 GAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTS- 174
            |.|:|||||....:...::|..||.|...|.|||..|...:.:|:...... |.|      ||| 
  Fly    71 GGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN-GLG------HTSL 128

  Fly   175 ---VTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPA 236
               :|..|.|||||.:..:||:|..|..||.......:..:..|:|:.........:||.|||||
  Fly   129 APNITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPA 193

  Fly   237 R----SFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLRQLED 293
            |    :||..:|..|    |:||:.|:......|..|..|...:.|.....::||.|...|
  Fly   194 RTVGTAFATDIWASH----WVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHAD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 73/222 (33%)
PripNP_001246266.1 MIP 12..226 CDD:294134 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I2575
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm9195
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.