DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Drip

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster


Alignment Length:256 Identity:83/256 - (32%)
Similarity:122/256 - (47%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KVFKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCV 109
            |:::|          .||||:||..|:|:| :|...:...|    ||...||..|....|..|.:
  Fly    21 KIWRM----------LLGELVGTFFLIFVG-VGSTTSGSVP----QIAFTFGLTVATIAQGLGHL 70

  Fly   110 SGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTS 174
            ||.|:|||||:...|...:::..|..|...|.:||..|..::.|.|..   ..|..|.|:....|
  Fly    71 SGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDG---VAGGDLGVSSFDPS 132

  Fly   175 VTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSF 239
            :...||:.||.:||.|||.|...|.||.......|..:..|||||.....|...:|.||||||||
  Fly   133 LNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSF 197

  Fly   240 APA----LWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLRQLEDVQL 296
            .||    :|..|    |:||:.|::...:....|:::|:.:........:|.|..|:.:::
  Fly   198 GPAVVQGVWTYH----WVYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQGHESLWSLDALRI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 77/216 (36%)
DripNP_001260893.1 MIP 23..227 CDD:294134 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438268
Domainoid 1 1.000 72 1.000 Domainoid score I2575
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51421
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.