DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AQP2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_000477.1 Gene:AQP2 / 359 HGNCID:634 Length:271 Species:Homo sapiens


Alignment Length:215 Identity:73/215 - (33%)
Similarity:107/215 - (49%) Gaps:5/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            |...|.:.|.:.||.|....:.......:.|||.:.||..:...:|..|.:||||:|||||||..
Human    12 AVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACL 76

  Fly   124 I-YEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVI 187
            : ..:..||.|| |.|||:|||..|..||..:.|:   .:...|.|.....|.|.|||:.:|..:
Human    77 VGCHVSVLRAAF-YVAAQLLGAVAGAALLHEITPA---DIRGDLAVNALSNSTTAGQAVTVELFL 137

  Fly   188 TSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNW 252
            |..||:......|.|..:...:..:..|.::|........:||.|||||||.|||:....|:.:|
Human   138 TLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHW 202

  Fly   253 IYWLAPLSSSAITAYAYKVV 272
            ::|:.||..:.:.:..|..|
Human   203 VFWIGPLVGAILGSLLYNYV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 72/213 (34%)
AQP2NP_000477.1 MIP 3..219 CDD:278651 71/210 (34%)
NPA 1. /evidence=ECO:0000305|PubMed:24733887 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:24733887 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140757
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.