DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp-12

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001022480.1 Gene:aqp-12 / 3565789 WormBaseID:WBGene00013272 Length:243 Species:Caenorhabditis elegans


Alignment Length:95 Identity:24/95 - (25%)
Similarity:42/95 - (44%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIY 125
            :||.:|..|..||.|..   .....:|.|.......|::.||......::.||||||:::..::.
 Worm    24 IGEFLGAVIFSFLACFA---GQYQRSNDLVYPFLSAFSLYIARCLVSHLTPAHLNPAISLLQWLR 85

  Fly   126 EMVTLRMAFAYFAAQMLGAFIGYGLLMVLL 155
            ..:.|.:...:...|::|...|..|...|:
 Worm    86 NEIPLVLLITFCFVQLIGFLFGVTLFRALV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 24/95 (25%)
aqp-12NP_001022480.1 MIP 24..>155 CDD:294134 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.