DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and bib

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster


Alignment Length:246 Identity:66/246 - (26%)
Similarity:108/246 - (43%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TLDKISAFLGELIGTGILVFLGC-------MGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVS 110
            ||:...:.:.|.:.:.:.||:.|       :|...:.:.    |...|..|.|:....|||..:|
  Fly    61 TLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVL----LATALASGLAMATLTQCFLHIS 121

  Fly   111 GAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLM-VLLPSPTLTVGAGLCVTLPHT- 173
            |||:|||||:|..:...::...|..|..||..|...|..||. |.:|.    ....|...:.|: 
  Fly   122 GAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPG----YQGNLQAAISHSA 182

  Fly   174 SVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARS 238
            ::...:..|:||::| .||::|..|......||..:.....|.|.:.....:.|:    :|||||
  Fly   183 ALAAWERFGVEFILT-FLVVLCYFVSTDPMKKFMGNSAASIGCAYSACCFVSMPY----LNPARS 242

  Fly   239 FAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLR 289
            ..|:.....::|:|:||..||.....:...|:.:|.        :.|..||
  Fly   243 LGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFN--------SRNRNLR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 60/221 (27%)
bibNP_001260313.1 MIP 58..273 CDD:278651 61/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I2575
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9195
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.