DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AQP8

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_011544124.1 Gene:AQP8 / 343 HGNCID:642 Length:262 Species:Homo sapiens


Alignment Length:203 Identity:70/203 - (34%)
Similarity:106/203 - (52%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVK--TDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            |.||:|:.:.:|:||:..::  ||   ...||..|..|.|:.:.|...|.:||.|.||||::||.
Human    40 LVELLGSALFIFIGCLSVIENGTD---TGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAM 101

  Fly   124 IYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLC-VTLPHTSVTTGQALGIEFVI 187
            :...:.|.|...|:.:|:||..:|..|...:.|.......:|.. ||:.......| ||..|.::
Human   102 LIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAG-ALVAEIIL 165

  Fly   188 TSILVI-VCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESN 251
            |::|.: ||.|..:.:.........|.|.:.:..|  |.||.:||.|||||:|.||:...|:..:
Human   166 TTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDIL--AGGPVSGGCMNPARAFGPAVVANHWNFH 228

  Fly   252 WIYWLAPL 259
            |||||.||
Human   229 WIYWLGPL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 70/203 (34%)
AQP8XP_011544124.1 MIP 39..232 CDD:294134 65/197 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4525
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.