DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp1a.1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_996942.1 Gene:aqp1a.1 / 335821 ZFINID:ZDB-GENE-030131-7764 Length:260 Species:Danio rerio


Alignment Length:214 Identity:68/214 - (31%)
Similarity:106/214 - (49%) Gaps:10/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFL---GCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTV 120
            |.|.||:|..:.:||   ..:|...|. .|:..:::.|.||.::....|..|.:||||||||||:
Zfish    12 AVLAELLGMTLFIFLSITAAVGNTNTQ-NPDQEIKVALAFGLSIATLAQSLGHISGAHLNPAVTL 75

  Fly   121 AAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEF 185
            .......::|..|..|..|||:||.:...:::      .::.|..|.:...||.::.||.:|||.
Zfish    76 GLLASCQISLLRAVMYILAQMIGATVASAIVL------GVSKGDALGLNQIHTDISAGQGVGIEL 134

  Fly   186 VITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFES 250
            :.|..||:......|.|......|..:..||::......|..|||..:||||:|.||:....|.:
Zfish   135 LATFQLVLCVLATTDKRRRDVSGSAPLAIGLSVCLGHLTAISFTGCGINPARTFGPAMIRLDFAN 199

  Fly   251 NWIYWLAPLSSSAITAYAY 269
            :|:||:.|:......|..|
Zfish   200 HWVYWVGPMCGGVAAALIY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 68/214 (32%)
aqp1a.1NP_996942.1 MIP 3..218 CDD:278651 67/212 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.