DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp7

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005161068.1 Gene:aqp7 / 334529 ZFINID:ZDB-GENE-030131-6461 Length:310 Species:Danio rerio


Alignment Length:267 Identity:72/267 - (26%)
Similarity:111/267 - (41%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GSTL----DKISAFLGELIGTGI-LVF-LGCMGCVKT-DLFPNNHLQIVLNFGFAVLIAIQCFGC 108
            ||.|    :.|...|.|.:.|.| :|| ||.:..|.| :.:...:|.|.:.||.||.:.:...|.
Zfish    15 GSMLKIKNEYIRVALAESLCTFIMMVFGLGTVAQVVTGEGYFGEYLSINIGFGLAVAMGVHVGGK 79

  Fly   109 VSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL------------------- 154
            |||||:|.||:....::..:..:|...|..||.||:|:..|.:..|                   
Zfish    80 VSGAHMNAAVSFTMCVFGRLRWKMLPLYVFAQFLGSFLAAGTIFSLYYAFVLLFIDAINHFCGGN 144

  Fly   155 --LPSPTLTVGAGLCVTLPHTSVTTG---QALGIEFVITSILVIVCCGVWDPRNSKF---HDSVG 211
              :..|..|.|.......|:.||.||   |..|     |.:|::....:.|.||...   .::||
Zfish   145 LTVSGPKATAGIFATYPAPYISVYTGFFDQVAG-----TGLLLLCLMALSDQRNQPLVSGGEAVG 204

  Fly   212 IRFGLAIACLACAAGPFTGGSMNPARSFAPAL------WNKH-FESN----WIYWLAPLSSSAIT 265
            :  ||.:..:..:.|..:|.::||.|...|.|      |... |.:.    |:..:||.....:.
Zfish   205 V--GLLVMLIGVSMGSNSGYAINPTRDLGPRLFTLMAGWGTEVFRAGNCWWWVPLVAPFIGGVLG 267

  Fly   266 AYAYKVV 272
            |..||.:
Zfish   268 ALIYKAL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 68/253 (27%)
aqp7XP_005161068.1 MIP 7..275 CDD:294134 72/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.