DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AgaP_AGAP010326

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_554502.2 Gene:AgaP_AGAP010326 / 3292445 VectorBaseID:AGAP010326 Length:267 Species:Anopheles gambiae


Alignment Length:220 Identity:96/220 - (43%)
Similarity:132/220 - (60%) Gaps:8/220 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FLGELIGTGILVFLGCMGCVKTDLFPN--NHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAA 122
            ||.|..||.:|:|.|||..:  |.|.|  :::...:.||..|::|...|...|||.:||.|::||
Mosquito    18 FLAEFFGTAMLLFGGCMASI--DGFDNVTSNISRGITFGMVVMMAFITFSASSGAIINPVVSLAA 80

  Fly   123 YIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLP----SPTLTVGAGLCVTLPHTSVTTGQALGI 183
            ||:..::|::...|..||..||..|||||..:.|    ...|..|...|||:||.|:::|.||.:
Mosquito    81 YIFGTLSLQLTILYIVAQFAGALCGYGLLRAVTPWQYYQQALEHGNAHCVTVPHQSLSSGMALAV 145

  Fly   184 EFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHF 248
            |.::|.:||...||||||||.|..|||.::|...||.|:.|.||.||.|||||||.|||:||.::
Mosquito   146 EILLTGMLVWTNCGVWDPRNKKDSDSVPVKFAFLIAGLSIAGGPITGASMNPARSLAPAIWNHYY 210

  Fly   249 ESNWIYWLAPLSSSAITAYAYKVVF 273
            |..|||:..|...|.:....|:.:|
Mosquito   211 EGLWIYFAGPTIGSLLMVTIYRYIF 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 95/217 (44%)
AgaP_AGAP010326XP_554502.2 MIP 18..234 CDD:294134 95/217 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26905
OrthoDB 1 1.010 - - D101773at6656
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.