DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp8

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_062031.1 Gene:Aqp8 / 29172 RGDID:2146 Length:263 Species:Rattus norvegicus


Alignment Length:227 Identity:67/227 - (29%)
Similarity:110/227 - (48%) Gaps:19/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KMKGSTLDKISAFLG-------------ELIGTGILVFLGCMGCVKTDLFPNNH-LQIVLNFGFA 98
            ::||...:...::.|             ||:|:.:.:|:||:..::..  ||.. ||..|..|.|
  Rat    15 EIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENS--PNTGLLQPALAHGLA 77

  Fly    99 VLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVG 163
            :.:.|...|.:||.|.||||::|..:...:...:...|:.:|:.|..||..|..|:.|.......
  Rat    78 LGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNA 142

  Fly   164 AGLCVTLPHTSVTTGQALGIEFVITSILVI-VCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGP 227
            :|....:........:|||:|.|:|.:||: ||.|..:.:.........|.|.:.:..|  |.|.
  Rat   143 SGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDIL--AGGG 205

  Fly   228 FTGGSMNPARSFAPALWNKHFESNWIYWLAPL 259
            .:|..|||||:|.||:...:::.:|||||.||
  Rat   206 ISGACMNPARAFGPAVMAGYWDFHWIYWLGPL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 65/216 (30%)
Aqp8NP_062031.1 MIP 40..250 CDD:294134 64/202 (32%)
NPA 1 94..96 1/1 (100%)
NPA 2 212..214 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.