DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp7

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_062030.2 Gene:Aqp7 / 29171 RGDID:2145 Length:269 Species:Rattus norvegicus


Alignment Length:267 Identity:73/267 - (27%)
Similarity:110/267 - (41%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MKGSTLDKISA---------FLGELIGTGILVFLGCMGCVKTDLFP---NNHLQIVLNFGFAVLI 101
            |.||.|:.|.:         ||.|.:.|.:|:..| :|.|...:..   .::|.:.|.|||.|.:
  Rat     1 MAGSVLENIQSVLQKTWVREFLAEFLSTYVLMVFG-LGSVAHMVLGERLGSYLGVNLGFGFGVTM 64

  Fly   102 AIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIG------------YGL---- 150
            .|...|.:||||:|.|||..    .....|||:..|...:||.|:|            ||.    
  Rat    65 GIHVAGGISGAHMNAAVTFT----NCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYGAINHY 125

  Fly   151 ----LMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNS-KFHDSV 210
                |:|..|..|..:.|   ..||. .:|..:....|..:|.:|.:....:.|..|| ....:.
  Rat   126 AGGELLVTGPKSTANIFA---TYLPE-HMTLWRGFVDEVFVTGMLQLCIFAITDKLNSPALQGTE 186

  Fly   211 GIRFGLAIACLACAAGPFTGGSMNPARSFAP------ALWNKHFES---NWIYWLAPLSSSAITA 266
            .:..|:.:..|..:.|..||.::||:|...|      |.|.|...|   ||  |..|:.:..:.|
  Rat   187 PLMIGILVCVLGVSLGMNTGYAINPSRDLPPRFFTFIAGWGKKVFSAGNNW--WWVPVVAPLLGA 249

  Fly   267 YAYKVVF 273
            |...:|:
  Rat   250 YLGGIVY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 67/254 (26%)
Aqp7NP_062030.2 MIP 15..260 CDD:412216 68/253 (27%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 78..80 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.