DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp6

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_071517.1 Gene:Aqp6 / 29170 RGDID:71100 Length:276 Species:Rattus norvegicus


Alignment Length:275 Identity:89/275 - (32%)
Similarity:129/275 - (46%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CCKVFKMKGSTLDKIS-AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCF 106
            |.:.:.:.|.....|| |...|.:.||:.||.|....:...:...:.||:.:.|..|...|:|..
  Rat     6 CNRAYLLVGGLWTAISKALFAEFLATGLYVFFGVGSVLPWPVALPSVLQVAITFNLATATAVQIS 70

  Fly   107 GCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLP 171
            ...||||.|||||:|..:...::|..|.||.|||:.||.:|..||..:.|.   .|...|.|.:.
  Rat    71 WKTSGAHANPAVTLAYLVGSHISLPRAVAYIAAQLAGATVGAALLYGVTPG---GVRETLGVNVV 132

  Fly   172 HTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPA 236
            |.|.:||||:.:|.|:|..||:......|.|.:.  .|.....|.::|........|||.|||||
  Rat   133 HNSTSTGQAVAVELVLTLQLVLCVFASMDSRQTL--GSPAAMIGTSVALGHLIGIYFTGCSMNPA 195

  Fly   237 RSFAPALWNKHFESNWIYWLAPLSSSAITAYAY--------KVVFRR-----------EVVEAEI 282
            |||.||:....|..:||:|:.||:.:.:.:..|        |.|.:|           :||:.|.
  Rat   196 RSFGPAVIVGKFAVHWIFWVGPLTGAVLASLIYNFILFPDTKTVAQRLAILVGTTKVEKVVDLEP 260

  Fly   283 TSNEKLRQLEDVQLS 297
            ...|.....||.::|
  Rat   261 QKKESQTNSEDTEVS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 76/220 (35%)
Aqp6NP_071517.1 MIP 22..228 CDD:294134 74/210 (35%)
NPA 1 79..81 1/1 (100%)
NPA 2 193..195 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.