DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Mip

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001099189.1 Gene:Mip / 25480 RGDID:3090 Length:263 Species:Rattus norvegicus


Alignment Length:211 Identity:71/211 - (33%)
Similarity:106/211 - (50%) Gaps:3/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            |...|...|...||.|....::....|.:.||:.|.||.|:...:|..|.:||||:|||||.|..
  Rat    12 AIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVALAFGLALATLVQTVGHISGAHVNPAVTFAFL 76

  Fly   124 IYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVIT 188
            :...::|..||.|.|||:|||..|..:|..:.|.   .|...|.:...|..|:.|||..:|..:|
  Rat    77 VGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPP---AVRGNLALNTLHAGVSVGQATTVEIFLT 138

  Fly   189 SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWI 253
            ...|:.....:|.|.:....||.:..|.::.........:||..||||||||||:..::|.::|:
  Rat   139 LQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFSNHWV 203

  Fly   254 YWLAPLSSSAITAYAY 269
            ||:.|:....:.:..|
  Rat   204 YWVGPIIGGGLGSLLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 71/211 (34%)
MipNP_001099189.1 MIP 3..219 CDD:278651 70/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.