DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and SPAC977.17

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_592788.1 Gene:SPAC977.17 / 2543301 PomBaseID:SPAC977.17 Length:598 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:65/247 - (26%)
Similarity:92/247 - (37%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CKV--FKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLN------------ 94
            ||:  |..:|         ..|.:||.:||..|.          .::||..:.            
pombe   304 CKIRHFFREG---------FAEFLGTLVLVVFGV----------GSNLQATVTNGAGGSFESLSF 349

  Fly    95 -FGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIG----YGLLMVL 154
             :||..::.:...|.:||.|:|||||::..|:..........|...|:.|||.|    ||.....
pombe   350 AWGFGCMLGVYIAGGISGGHVNPAVTISLAIFRKFPWYKVPIYIFFQIWGAFFGGALAYGYHWSS 414

  Fly   155 LP-----SPTLTVGAGLCV-TLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNS-KFHDSVGI 212
            :.     ....|...|.|: |.|...||...|...||:.|::||.....:.|..|| ........
pombe   415 ITEFEGGKDIRTPATGGCLYTNPKPYVTWRNAFFDEFIGTAVLVGCLFAILDDTNSPPTQGMTAF 479

  Fly   213 RFGLAIACLACAAGPFTGGSMNPARSFAP---ALW------NKHFESNWIYW 255
            ..||.||.:..|.|..|..::||||...|   |.|      :.|....|..|
pombe   480 IVGLLIAAIGMALGYQTSFTLNPARDLGPRMFAWWIGYGPHSFHLYHWWWTW 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 61/230 (27%)
SPAC977.17NP_592788.1 MIP 311..520 CDD:238204 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I2575
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47106
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.