DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_037041.3 Gene:Aqp2 / 25386 RGDID:2142 Length:271 Species:Rattus norvegicus


Alignment Length:212 Identity:77/212 - (36%)
Similarity:109/212 - (51%) Gaps:5/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            |.|.|.:.|.:.||.|....::....|.:.|||.:.||..:...:|..|.|||||:|||||||..
  Rat    12 AVLAEFLATLLFVFFGLGSALQWASSPPSVLQIAVAFGLGIGTLVQALGHVSGAHINPAVTVACL 76

  Fly   124 IYEMVT-LRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVI 187
            :...|: ||.|| |.|||:|||..|..:|..:.|   :.:...|.|...|.:.|.|||:.:|..:
  Rat    77 VGCHVSFLRAAF-YVAAQLLGAVAGAAILHEITP---VEIRGDLAVNALHNNATAGQAVTVELFL 137

  Fly   188 TSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNW 252
            |..||:......|.|......|..:..|.::.........|||.|||||||.|||:....|:.:|
  Rat   138 TMQLVLCIFASTDERRGDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHW 202

  Fly   253 IYWLAPLSSSAITAYAY 269
            ::|:.||..:.|.:..|
  Rat   203 VFWIGPLVGAIIGSLLY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 77/212 (36%)
Aqp2NP_037041.3 MIP 3..219 CDD:395174 76/210 (36%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P41181 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P41181 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.