DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp5

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_036911.1 Gene:Aqp5 / 25241 RGDID:2144 Length:265 Species:Rattus norvegicus


Alignment Length:223 Identity:75/223 - (33%)
Similarity:110/223 - (49%) Gaps:4/223 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGA 112
            |.:..:|....|...|.:.|.|.||.|....:|........|||.:.||.|:....|..|.|||.
  Rat     2 KKEVCSLAFFKAVFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQALGPVSGG 66

  Fly   113 HLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTT 177
            |:|||:|:|..|...::|..|..|.|||::||..|.|:|..|.|   |.....|.|...:.:.|.
  Rat    67 HINPAITLALLIGNQISLLRAVFYVAAQLVGAIAGAGILYWLAP---LNARGNLAVNALNNNTTP 128

  Fly   178 GQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPA 242
            |:|:.:|.::|..|.:......|.|.:....|..:..||::.........|||.||||||||.||
  Rat   129 GKAMVVELILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPA 193

  Fly   243 -LWNKHFESNWIYWLAPLSSSAITAYAY 269
             :.|:...|:|::|:.|:..:.:.|..|
  Rat   194 VVMNRFSPSHWVFWVGPIVGAMLAAILY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 73/212 (34%)
Aqp5NP_036911.1 MIP 4..221 CDD:395174 73/219 (33%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 69..71 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 185..187 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.