DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp-3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_502044.1 Gene:aqp-3 / 190553 WormBaseID:WBGene00000171 Length:421 Species:Caenorhabditis elegans


Alignment Length:280 Identity:74/280 - (26%)
Similarity:118/280 - (42%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVKTDLF-----PNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNP 116
            |.|||.||..||.|||.|  .||.....     .|..:.|.:.:|..:::|:.....:|||||||
 Worm   120 IRAFLAELFCTGFLVFGG--ECVNAQYVLSQGKNNEWIGISVGWGLVLMLAVLMGSKISGAHLNP 182

  Fly   117 AVTVAAYIYEMVTLRMAFAYFAAQMLGAFIG-YGLLMV-------------LLPSPTLTVGAGLC 167
            ||:........:.|.....|..||.:|||:| :|:..|             .:..||.|  |.:.
 Worm   183 AVSFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCVYYDAINVFEGGNRTVTGPTAT--ASIF 245

  Fly   168 VTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIR-------FGLAIACLACAA 225
            .|.|...:.|..|:..:...|.:|.:....:.|.||       ||.       .|..:|.|..:.
 Worm   246 ATYPGPFLGTFNAIVDQIAGTLVLCLGVAAITDRRN-------GIPAFLQPAWIGALLAFLGMSL 303

  Fly   226 GPFTGGSMNPARSFAPALWN------------KHFESNWIYWLAPLSSSAITAYAYKV-----VF 273
            ....|.::||||.|||.|:|            ::::..||..:.|:....:.|:.|:.     :.
 Worm   304 ALNAGYAINPARDFAPRLFNLCAGYGWEVFSYRNYKWFWIPIICPMIGGVLGAWLYEFFIGFHIQ 368

  Fly   274 RREVVEAEITSNEKLRQLED 293
            ..:.|..:..|:::|:.:.|
 Worm   369 DEDAVSLDSESDKQLKTMID 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 69/255 (27%)
aqp-3NP_502044.1 MIP 121..362 CDD:238204 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.