DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp-5

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_505691.2 Gene:aqp-5 / 183221 WormBaseID:WBGene00000173 Length:316 Species:Caenorhabditis elegans


Alignment Length:291 Identity:67/291 - (23%)
Similarity:106/291 - (36%) Gaps:78/291 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KGSTL---DKISAFLGELIGTGILVFLGCMGCVKTDLF-PNNHLQIVLNFGFAVLIAIQCFGCVS 110
            |.||:   :.||....|.:||.|.:|.|.|.....|:. |.......|..|.|.::.|..||.:|
 Worm    33 KTSTVRPYNLISRCYAEFLGTFIFIFSGTMQANVYDISQPVGLTHAALTHGLATIVVIAVFGKIS 97

  Fly   111 GAHLNPAVTVAAYIYEMV-TLRMAFAYFAAQMLGAFIGYGLLMVLL-----------------PS 157
            |.|.||.|:.|..:.:.: ...:.| |..:|..|.|.| .||...|                 |.
 Worm    98 GGHFNPVVSWAMVLCQKLHPFELPF-YMFSQFFGGFAG-NLLSACLQRKRDFLNWEDYSSIRYPL 160

  Fly   158 PTLTVGAG------------LCVTLPHTSVTTG----------------QALGIEFVITSILVIV 194
            ||.::..|            :.:|....:.|:|                :.:...|.:|.||:.|
 Worm   161 PTASIEYGYDKVHNSTLEKTILLTTQLAATTSGITHLGENHEWWEGLISETITTYFFVTVILMNV 225

  Fly   195 CCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPAL---------------W 244
            .       |::..::.....|:.:.....|....||.:|||.|:.:|.:               |
 Worm   226 V-------NNEPSEATPFIIGMMVIVNIFATASITGTAMNPVRALSPNIVGEIVLSSSSLPPNFW 283

  Fly   245 NKHFESNWIYWLAPLSSSAITAYAYKVVFRR 275
            ..|:    |||..|...|.|....:|::..:
 Worm   284 TYHY----IYWAGPYLGSTIAVIGFKLLLSK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 62/274 (23%)
aqp-5NP_505691.2 MIP 45..307 CDD:294134 62/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.