DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqp-4

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_505512.3 Gene:aqp-4 / 179366 WormBaseID:WBGene00000172 Length:273 Species:Caenorhabditis elegans


Alignment Length:261 Identity:80/261 - (30%)
Similarity:107/261 - (40%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KMKGSTLDK-ISAFLGELIGTGILVFLGCMGCVKTDLF--PNNHLQIVLNFGFAVLIAIQCFGCV 109
            |.:.|.|.| ::.|||:|    ..|::|.|   :..||  .:..|......||.:.|.:..||.:
 Worm    38 KKEYSLLTKCVAEFLGDL----TFVYVGTM---QASLFQYADGILHAAFAHGFTIFILVTAFGHI 95

  Fly   110 SGAHLNPAVTVA-AYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLT---VGAGLCVTL 170
            ||.|.||||:.| |...:|....:.| |..:|:||...|..|...:|....||   .||    ||
 Worm    96 SGGHFNPAVSWAIAGAGKMPIFHLPF-YVVSQLLGGICGAFLTAAVLSQEQLTSCEAGA----TL 155

  Fly   171 PHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFH---------DSV---GIRFGLAIACLAC 223
            ........|.|..|.|:|..||              |         |:|   .:..||.::....
 Worm   156 LSPGSQWWQGLIAETVVTFFLV--------------HTILITAADTDTVTLAPLAIGLTLSIDIL 206

  Fly   224 AAGPFTGGSMNPARSFAPAL-------------WNKHFESNWIYWLAPLSSSAITAYAYKVVFRR 275
            :.|..||.|||||||..|::             ||.|:    |||..||..|.|....||:...|
 Worm   207 STGSITGASMNPARSLGPSIIGSIFATQKTSFYWNNHY----IYWAGPLLGSTIALCIYKLFESR 267

  Fly   276 E 276
            |
 Worm   268 E 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 74/243 (30%)
aqp-4NP_505512.3 MIP 46..264 CDD:238204 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.