DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AgaP_AGAP008843

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_319585.4 Gene:AgaP_AGAP008843 / 1279813 VectorBaseID:AGAP008843 Length:270 Species:Anopheles gambiae


Alignment Length:239 Identity:78/239 - (32%)
Similarity:106/239 - (44%) Gaps:15/239 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILV--FLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA 121
            |.|.|.:||.|.:  |..|..|...:   .:...|.|.||.:|.:.:...|.:||.|:|||||..
Mosquito    22 ALLAEFVGTCIFILNFFACAACTHAN---GDKTLISLAFGLSVFMVVMSIGHISGGHINPAVTAG 83

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFV 186
            ......|:|..|..|.|||..||......|.||:|.   :...||..|.....||..|.||.||.
Mosquito    84 MLAAGKVSLIRALMYVAAQCAGAVAATTALDVLIPK---SFQNGLGNTGLKEGVTDMQGLGFEFF 145

  Fly   187 ITSILVIVCCGVWDPR--NSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFE 249
            :..:||:...||.|..  :|:|...:.|  ||.:.........:||.||||||||..|.....:.
Mosquito   146 LGFVLVLCVFGVCDENKPDSRFVAPLAI--GLTVTLGHLGVVEYTGSSMNPARSFGTAFVTDSWA 208

  Fly   250 SNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLRQLED 293
            .:||||..|:......|..|..:|:.....   .::|:.|...|
Mosquito   209 HHWIYWAGPILGGVTAALLYCQLFKAPTAS---DASERYRTSAD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 74/216 (34%)
AgaP_AGAP008843XP_319585.4 MIP 13..228 CDD:294134 73/213 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.