DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AgaP_AGAP010325

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_318238.4 Gene:AgaP_AGAP010325 / 1278605 VectorBaseID:AGAP010325 Length:264 Species:Anopheles gambiae


Alignment Length:235 Identity:132/235 - (56%)
Similarity:174/235 - (74%) Gaps:7/235 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAH 113
            ||.||||.||.||.||||||:||.|||||||.......:|.::.:|||..|:|.:|.||||||:|
Mosquito    12 MKKSTLDNISVFLAELIGTGLLVMLGCMGCVSGLGHTPSHFELCINFGLIVMIIVQIFGCVSGSH 76

  Fly   114 LNPAVTVAAYIYEMVTLRMA--FAYFAAQMLGAFIGYGLLMVLLPSPTLTV----GAGLCVTLPH 172
            ||||||.||::||:|:.::.  |..| :|.:|||:|||:|.:|.|:....|    |||.|||.|:
Mosquito    77 LNPAVTAAAWVYELVSTKVGALFLIF-SQCIGAFMGYGILKLLTPASVFDVALEKGAGFCVTQPN 140

  Fly   173 TSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPAR 237
            ::::..||:|||||.|.:|::||||||||||:|.||||.::||..:..||.||||:||.||||||
Mosquito   141 SAISNMQAVGIEFVATMVLILVCCGVWDPRNAKHHDSVALKFGFTVGALAVAAGPYTGASMNPAR 205

  Fly   238 SFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREV 277
            |..|.|||..:.::||||:.||.::.:||:|||.||||||
Mosquito   206 SLGPVLWNGVYNAHWIYWVGPLGAAFLTAFAYKAVFRREV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 118/218 (54%)
AgaP_AGAP010325XP_318238.4 MIP 15..237 CDD:294134 121/222 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H136579
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26905
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19139
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.