DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AgaP_AGAP008767

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_314891.4 Gene:AgaP_AGAP008767 / 1275624 VectorBaseID:AGAP008767 Length:592 Species:Anopheles gambiae


Alignment Length:234 Identity:64/234 - (27%)
Similarity:105/234 - (44%) Gaps:30/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TLDKISAFLGELIGTGILVFLGC-------MGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVS 110
            ||:...:...|.:.:...||:.|       :|...:.|.    |...|..|..|::..|||..||
Mosquito    57 TLELWRSVTSECLASFFYVFVVCGAAAGAGVGASVSSLL----LATSLASGLIVIVLTQCFLHVS 117

  Fly   111 GAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLM-VLLPSPTLTVGAGLCVTLPHTS 174
            |||:|||||:|..:...::...|..|..||..|:..|..:|. |.:|.    ....|...:.|::
Mosquito   118 GAHINPAVTMALAVTRKISALRAILYITAQCGGSIAGAAMLYGVTVPG----YQGNLQAAVSHSA 178

  Fly   175 -VTTGQALGIEFVITSILV----IVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMN 234
             :...:..|:||::|.|:|    |..|..     .|:..|..|..|.|.:..:..:.|:    :|
Mosquito   179 QLAPWERFGVEFILTFIVVLAYLISTCSF-----KKYFGSSAIVIGAAYSACSFVSMPY----LN 234

  Fly   235 PARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVF 273
            ||||..|:.....::::|:||:.|.....|....::.||
Mosquito   235 PARSLGPSFVLNKWDNHWVYWIGPFFGGIIAGLIHQFVF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 60/225 (27%)
AgaP_AGAP008767XP_314891.4 MIP 54..269 CDD:278651 62/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.