DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AgaP_AGAP008766

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_314890.4 Gene:AgaP_AGAP008766 / 1275623 VectorBaseID:AGAP008766 Length:548 Species:Anopheles gambiae


Alignment Length:286 Identity:68/286 - (23%)
Similarity:129/286 - (45%) Gaps:24/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ACDREGSSLFSVALFKRFSDHFSCCKVFKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLF 84
            |..:|.....|.:|..|.:.|.....:...:..|.:.:::|....|..|.....|....|.:.| 
Mosquito    26 AMRKEPGQKLSRSLQGRINMHTELRSLELWRSITCESLASFFYVFIVCGAAAGAGVGASVSSVL- 89

  Fly    85 PNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYG 149
                |...|:.||:::...|||..:||||:||||::...:...::...|..|..||..|:..|..
Mosquito    90 ----LATALSSGFSMIALTQCFLHISGAHVNPAVSIGMLVSRQISPLRALLYIVAQSGGSIAGAA 150

  Fly   150 LLM-VLLPSPTLTVGAGLCVTLPH-TSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGI 212
            ||. |.:|.    ....|...:.| :|:...:..|:||::|.|:|:... :......|:..|..|
Mosquito   151 LLYGVTVPG----YQGNLQAAVSHSSSLAAWERFGVEFILTFIVVLAYL-ISTSSFKKYFGSSAI 210

  Fly   213 RFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVF---- 273
            ..|.|.:..:..:.|:    :|||||..|:.....::::|:||:.|:...|::...::.:|    
Mosquito   211 AIGAAYSACSFVSMPY----LNPARSLGPSFVLNKWDNHWVYWVGPMVGGAVSGVLHEFIFSAKR 271

  Fly   274 ----RREVVEAEITSNEKLRQLEDVQ 295
                .::.|::.:.|.:.:....|::
Mosquito   272 SSKRTKDDVDSSLNSEDDINYDMDLE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 57/214 (27%)
AgaP_AGAP008766XP_314890.4 MIP 48..263 CDD:278651 58/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.