DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp8

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_031500.1 Gene:Aqp8 / 11833 MGIID:1195271 Length:261 Species:Mus musculus


Alignment Length:218 Identity:67/218 - (30%)
Similarity:109/218 - (50%) Gaps:10/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CKVFKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPNNH-LQIVLNFGFAVLIAIQCFG 107
            |:||..:    ..:...:.||:|:.:.:|:||:..::..  ||.. ||..|..|.|:.:.|...|
Mouse    26 CRVFWYE----QYVQPCIVELVGSALFIFIGCLSVIENS--PNTGLLQPALAHGLALGLIIATLG 84

  Fly   108 CVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPH 172
            .:||.|.||||::|..:...:...:...|:.:|:.|..||..|..|:.|.......:|....:..
Mouse    85 NISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFGGLIGAALAKVVSPEERFWNASGAAFAIVQ 149

  Fly   173 TSVTTGQALGIEFVITSILVI-VCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPA 236
            ......:|||||.::|.:||: ||.|..:.:.........|.|.:.:..|  |.|..:|..||||
Mouse   150 EQEQVAEALGIEIILTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDIL--AGGSISGACMNPA 212

  Fly   237 RSFAPALWNKHFESNWIYWLAPL 259
            |:|.||:...:::.:|||||.||
Mouse   213 RAFGPAVMAGYWDFHWIYWLGPL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 64/203 (32%)
Aqp8NP_031500.1 MIP 38..248 CDD:294134 64/202 (32%)
NPA 1 92..94 1/1 (100%)
NPA 2 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830757
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.