DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp7

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001365567.1 Gene:Aqp7 / 11832 MGIID:1314647 Length:316 Species:Mus musculus


Alignment Length:219 Identity:57/219 - (26%)
Similarity:93/219 - (42%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 STLDK--ISAFLGELIGTGILVFLGCMGCVKTDLFPNN---HLQIVLNFGFAVLIAIQCFGCVSG 111
            |.|.|  :..||.|.:.|.:::..| :|.|...:...|   :|.:.|.|||.|.:.:...|.:||
Mouse    12 SVLQKNMVREFLAEFLSTYVMMVFG-LGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISG 75

  Fly   112 AHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAF--------IGYGLLMVLLPSPTLTVG----A 164
            ||:|.|||........:|.:....|...|.||:|        |.||.:........|..|    |
Mouse    76 AHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFAGGDLLVTGSKATA 140

  Fly   165 GLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNS-KFHDSVGIRFGLAIACLACAAGPF 228
            .:..|.....:|..:....|..:|.:|.:....:.|.:|| ....:..:..|:.:..|..:.|..
Mouse   141 NIFATYLPEYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMN 205

  Fly   229 TGGSMNPARSFAPALWNKHFESNW 252
            :|.::||:|...|.|:.  |.:.|
Mouse   206 SGYAINPSRDLPPRLFT--FIAGW 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 54/210 (26%)
Aqp7NP_001365567.1 MIP 18..232 CDD:412216 54/213 (25%)
NPA 1 79..81 1/1 (100%)
NPA 2 211..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.