DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_057898.2 Gene:Aqp3 / 11828 MGIID:1333777 Length:292 Species:Mus musculus


Alignment Length:274 Identity:82/274 - (29%)
Similarity:121/274 - (44%) Gaps:52/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDLFPNNH---LQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA- 121
            |.|.:||.|||..||....:..|....|   |.|.|.|||||.:.|...|.|||||||||||.| 
Mouse    26 LAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAM 90

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIGYGL----------------LMVLLPSPTLTVGAGLCVTL 170
            .::.....:::.. |..||.||||:|.|:                |.|..|:.|    ||:..|.
Mouse    91 CFLAREPWIKLPI-YALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSGPNGT----AGIFATY 150

  Fly   171 P--HTSVTTG---QALGIEFVITSILVIVCCGVWDPRNSKFHDSV-GIRFGLAIACLACAAGPFT 229
            |  |..:..|   |.:|...:|..:|.||     ||.|:.....: ....||.:..:..:.|..:
Mouse   151 PSGHLDMVNGFFDQFIGTAALIVCVLAIV-----DPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS 210

  Fly   230 GGSMNPARSFAPAL------WNKHFESN-----WIYWLAPLSSSAITAYAYKVVFRREVVEAEIT 283
            |.::||||.|.|.|      |.....:.     |:..::||..|....:.|:::....:.:...:
Mouse   211 GYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPS 275

  Fly   284 SNEKLRQLEDVQLS 297
            :.|     |:|:|:
Mouse   276 TEE-----ENVKLA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 78/247 (32%)
Aqp3NP_057898.2 MIP 23..264 CDD:238204 78/247 (32%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830726
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.