DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_031498.1 Gene:Aqp1 / 11826 MGIID:103201 Length:269 Species:Mus musculus


Alignment Length:257 Identity:67/257 - (26%)
Similarity:114/257 - (44%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCV-------KTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNP 116
            |.:.|.:...:.||:.....:       :......:::::.|.||.::....|..|.:|||||||
Mouse    13 AVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNP 77

  Fly   117 AVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTS------- 174
            |||:...:...:::..|..|..||.:||.:...:|            :|:..:|...|       
Mouse    78 AVTLGLLLSCQISILRAVMYIIAQCVGAIVATAIL------------SGITSSLVDNSLGRNDLA 130

  Fly   175 --VTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPAR 237
              |.:||.||||.:.|..||:......|.|......|..:..||::|.....|..:||..:||||
Mouse   131 HGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPAR 195

  Fly   238 SFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKL---RQLEDVQL 296
            ||..|:..::|.::||:|:.|....|:....|..:....  .::.|...|:   .|:|:..|
Mouse   196 SFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFILAPR--SSDFTDRMKVWTSGQVEEYDL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 62/228 (27%)
Aqp1NP_031498.1 MIP 4..227 CDD:278651 61/225 (27%)
NPA 1 76..78 1/1 (100%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.