DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and LOC101885864

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005174182.1 Gene:LOC101885864 / 101885864 -ID:- Length:277 Species:Danio rerio


Alignment Length:232 Identity:73/232 - (31%)
Similarity:111/232 - (47%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA 121
            :||.||.|:.       |..|.....::|      .|..|.|.::...|||.:|||.:|||||||
Zfish    27 VSAVLGSLVP-------GPDGVSPGPIYP------ALAAGMATVVLGYCFGEISGAQVNPAVTVA 78

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFV 186
            ......|.:..|..|..||.||..:..||:.:.||   |...|...:......:..|||||:|.:
Zfish    79 LLATRKVDVLRAVVYLVAQCLGGILATGLMYLSLP---LKSTAQNYINKVPVEMNAGQALGMEML 140

  Fly   187 ITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESN 251
            .|.:|......|.|.|..:.::...:..|||:......||.|:|.|:|||||..||:...::|.:
Zfish   141 ATFLLGFTVFSVEDQRRREINEPGNLAIGLAVTTAIFIAGRFSGASLNPARSLGPAIILGYWEHH 205

  Fly   252 WIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKL 288
            |:||:.|:..:.:...:::.:|      |...|.:||
Zfish   206 WVYWIGPILGAVLAGVSHEFIF------APSASRQKL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 67/212 (32%)
LOC101885864XP_005174182.1 MIP 6..223 CDD:412216 68/211 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.