DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and LOC101733960

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_031752084.1 Gene:LOC101733960 / 101733960 -ID:- Length:228 Species:Xenopus tropicalis


Alignment Length:223 Identity:71/223 - (31%)
Similarity:102/223 - (45%) Gaps:17/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGIL--VFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            |.|.:||.:|  |.|| ..|:...:..::.|...|..||.|:..:||||.:|||.||||:|.|..
 Frog    17 LAETLGTFMLVTVVLG-SSCLGLRVSRSDSLLPALAAGFTVVSLVQCFGEISGAQLNPAITSALV 80

  Fly   124 IYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLC---VTLPHTSVTTGQALGIEF 185
            ....:.|....|:..||.:||.....|..|.:|.       .:|   ||...:....||||.:|.
 Frog    81 CARKLDLLHGMAFAVAQCVGATCASALFYVCMPE-------SVCNQLVTRVSSEGNAGQALAMEV 138

  Fly   186 VITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFES 250
            ..|..|......|.|.|.....:...:..|.::...|..||..:|||||||||..|||....:|.
 Frog   139 FATFQLAFTIFAVDDRRRRDLTEPGSLAIGFSVTAGALTAGQVSGGSMNPARSLGPALVTGIWEH 203

  Fly   251 NWIYWLAPLSSSAITAYAYKVVFRREVV 278
            :|    |.|..:.......::.:|:::|
 Frog   204 HW----ASLKQNKFLLTLVRMHWRKKLV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 69/215 (32%)
LOC101733960XP_031752084.1 MIP 6..205 CDD:412216 66/195 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.