DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and LOC100498424

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_002938439.1 Gene:LOC100498424 / 100498424 -ID:- Length:234 Species:Xenopus tropicalis


Alignment Length:75 Identity:15/75 - (20%)
Similarity:27/75 - (36%) Gaps:23/75 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SAFLGELIGTGILVFLGC--MGCVK---------TDLFPNNHLQIVL---------NFGFAVLIA 102
            :|:.|:.:...:|:..|.  ..|.|         ..|||:..|.::.         |:|...:..
 Frog    72 AAYKGQRLAMELLLHYGANVNSCCKHGGTPLHAAIGLFPDCALLLIQHGADVNLQDNWGVTPMYL 136

  Fly   103 IQCFG---CV 109
            ..|.|   |:
 Frog   137 AACSGQTECI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 15/74 (20%)
LOC100498424XP_002938439.1 Ank_2 <28..93 CDD:372319 4/20 (20%)
ANK repeat 31..62 CDD:293786
ANK repeat 64..95 CDD:293786 4/22 (18%)
Ank_2 69..160 CDD:372319 15/75 (20%)
ANK repeat 97..127 CDD:293786 4/29 (14%)
ANK repeat 129..160 CDD:293786 4/18 (22%)
SOCS_ASB_like 185..226 CDD:239686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.