powered by:
Protein Alignment Eglp4 and LOC100498424
DIOPT Version :9
Sequence 1: | NP_001261154.1 |
Gene: | Eglp4 / 37739 |
FlyBaseID: | FBgn0034885 |
Length: | 297 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002938439.1 |
Gene: | LOC100498424 / 100498424 |
-ID: | - |
Length: | 234 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 15/75 - (20%) |
Similarity: | 27/75 - (36%) |
Gaps: | 23/75 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 SAFLGELIGTGILVFLGC--MGCVK---------TDLFPNNHLQIVL---------NFGFAVLIA 102
:|:.|:.:...:|:..|. ..|.| ..|||:..|.::. |:|...:..
Frog 72 AAYKGQRLAMELLLHYGANVNSCCKHGGTPLHAAIGLFPDCALLLIQHGADVNLQDNWGVTPMYL 136
Fly 103 IQCFG---CV 109
..|.| |:
Frog 137 AACSGQTECI 146
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0580 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X153 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.