DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and LOC100497434

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_002937066.2 Gene:LOC100497434 / 100497434 -ID:- Length:259 Species:Xenopus tropicalis


Alignment Length:237 Identity:68/237 - (28%)
Similarity:114/237 - (48%) Gaps:26/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KMKGSTLDK-ISAFLGELIGTGILVFLGCMGCVKTDLFPNN--HLQIVLNFGFAVLIAIQCFGCV 109
            |.:.|.|:| |...:.||:|:.:.:||||:..:   :.|:|  .|...|..||.:...|...|.|
 Frog    26 KEEPSVLEKYIQPCVAELLGSTLFIFLGCLSVL---VNPHNAGPLLPALVHGFTLASVISVLGNV 87

  Fly   110 SGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQ----MLGAFIGYGLL----MVLLPSPTLTVGAGL 166
            ||.|.|||||::..|...:|..:...|:..|    ||||.:..||.    .:........:|:|.
 Frog    88 SGGHFNPAVTLSVVICGGLTPILLVPYWVCQLSGGMLGALLAKGLADHGSFINHTGAACMLGSGD 152

  Fly   167 CVTLPHTSVTTGQALGIEFVITSILVI-VCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTG 230
            .|         .:|:|:|.|::.:|:. |..|.....:........|.|.|..|.|  :.|..:|
 Frog   153 LV---------ARAVGVEIVLSFLLIFTVVMGAVGELSKTPLAPYSIAFVLTAAIL--SGGSISG 206

  Fly   231 GSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVV 272
            ..:||||:..||:...:::.:|:||:.||:.:.:.:..|:.:
 Frog   207 SCLNPARALGPAVVANYWDYHWVYWVGPLAGALLVSLLYRFI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 63/223 (28%)
LOC100497434XP_002937066.2 MIP 34..245 CDD:294134 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4373
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.